PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g035430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family S1Fa-like
Protein Properties Length: 69aa    MW: 7598.25 Da    PI: 10.7353
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g035430.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA134.33e-42369470
              S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                      + ve+ G+nPGlivllv+ggl+l+fl+gny+lyvyaqk+lPP+kkkP+skkk+k+e+lkqGv++PGe
  Sopen10g035430.1  3 KDVEVNGFNPGLIVLLVIGGLVLTFLIGNYVLYVYAQKTLPPKKKKPISKKKMKKERLKQGVSAPGE 69
                      568***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046894.1E-40569IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MAKDVEVNGF NPGLIVLLVI GGLVLTFLIG NYVLYVYAQK TLPPKKKKPI SKKKMKKERL  60
KQGVSAPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-114HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249690.11e-41PREDICTED: DNA-binding protein S1FA-like
RefseqXP_006361668.11e-41PREDICTED: DNA-binding protein S1FA-like
RefseqXP_015055951.11e-41PREDICTED: DNA-binding protein S1FA-like
RefseqXP_015055952.11e-41PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016543084.11e-41PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016543085.11e-41PREDICTED: DNA-binding protein S1FA-like
SwissprotQ423372e-16S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLM1BVN71e-41M1BVN7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000453311e-40(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31742249